FLJ20489 (C-Term) anticorps

N° du produit ABIN635609

L’anticorps Lapin Polyclonal anti- a été validé pour IHC et WB. Il convient pour détecter dans des échantillons de Humain.

Aperçu rapide pour FLJ20489 (C-Term) anticorps (ABIN635609)

Antigène: FLJ20489

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Détail du produit

Épitope: C-Term

Specificité: FLJ20489 antibody was raised against the C terminal of FLJ20489

Purification: Affinity purified

Immunogène: FLJ20489 antibody was raised using the C terminal of FLJ20489 corresponding to a region with amino acids LISGDSPASAFQSAGIIGVSHRARPGSVFLARSEESLYLRPGQQSQEVKV

Information d'application

Indications d'application: WB: 0.0625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FLJ20489 Blocking Peptide, (ABIN940449), is also available for use as a blocking control in assays to test for specificity of this FLJ20489 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ20489 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: FLJ20489

Sujet: FLJ20489 is a heme transporter that regulates intracellular heme availability through the endosomal or lysosomal compartment.

Poids moléculaire: 26 kDa (MW of target protein)